CacheBy
Atlas Antibodies Anti-ITPR1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ITPR1 Antibody

상품 한눈에 보기

Human ITPR1 단백질을 인식하는 Rabbit Polyclonal Antibody. IHC 및 WB 실험에 적합. PrEST 항원을 이용한 Affinity 정제. 높은 종간 반응성(인간, 생쥐, 랫드). 안정한 PBS/glycerol buffer로 보존.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA016487-100 Anti-ITPR1 Antibody, inositol 1,4,5-trisphosphate receptor, type 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA016487-25 Anti-ITPR1 Antibody, inositol 1,4,5-trisphosphate receptor, type 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ITPR1 Antibody

Anti-ITPR1 Antibody

Target: inositol 1,4,5-trisphosphate receptor, type 1
Product Type: Polyclonal Antibody against Human ITPR1


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Rabbit polyclonal antibody recognizing Human ITPR1 (inositol 1,4,5-trisphosphate receptor, type 1).


Alternative Gene Names

ACV, Insp3r1, IP3R1, PPP1R94, SCA15, SCA16, SCA29

Open Datasheet (PDF)


Antigen Information

항목 내용
Antigen Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence KDDFILEVDRLPNETAVPETGESLASEFLFSDVCRVESGENCSSPAPREELVPAEETEQDKEHTCETLLMCIVTVLSHGLRS

Target Information

항목 내용
Target Protein inositol 1,4,5-trisphosphate receptor, type 1
Target Gene ITPR1
Verified Species Reactivity Human
Ortholog Identity Mouse (91%), Rat (89%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen as ligand

Buffer Composition

40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.