
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ITPR1 Antibody
상품 한눈에 보기
Human ITPR1 단백질을 인식하는 Rabbit Polyclonal Antibody. IHC 및 WB 실험에 적합. PrEST 항원을 이용한 Affinity 정제. 높은 종간 반응성(인간, 생쥐, 랫드). 안정한 PBS/glycerol buffer로 보존.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA016487-100 Anti-ITPR1 Antibody, inositol 1,4,5-trisphosphate receptor, type 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA016487-25 Anti-ITPR1 Antibody, inositol 1,4,5-trisphosphate receptor, type 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ITPR1 Antibody
Anti-ITPR1 Antibody
Target: inositol 1,4,5-trisphosphate receptor, type 1
Product Type: Polyclonal Antibody against Human ITPR1
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Rabbit polyclonal antibody recognizing Human ITPR1 (inositol 1,4,5-trisphosphate receptor, type 1).
Alternative Gene Names
ACV, Insp3r1, IP3R1, PPP1R94, SCA15, SCA16, SCA29
Antigen Information
| 항목 | 내용 |
|---|---|
| Antigen Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | KDDFILEVDRLPNETAVPETGESLASEFLFSDVCRVESGENCSSPAPREELVPAEETEQDKEHTCETLLMCIVTVLSHGLRS |
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | inositol 1,4,5-trisphosphate receptor, type 1 |
| Target Gene | ITPR1 |
| Verified Species Reactivity | Human |
| Ortholog Identity | Mouse (91%), Rat (89%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen as ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



