CacheBy
Atlas Antibodies Anti-ITPKB Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ITPKB Antibody

상품 한눈에 보기

인간 ITPKB 단백질을 인식하는 폴리클로날 토끼 항체. PrEST 항원을 이용해 친화 정제됨. IHC 및 RNA-seq 비교를 통한 정교한 단백질 발현 검증에 적합. 인간 반응성 확인 및 높은 종간 서열 유사성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA072923-100 Anti-ITPKB Antibody, inositol-trisphosphate 3-kinase B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA072923-25 Anti-ITPKB Antibody, inositol-trisphosphate 3-kinase B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ITPKB Antibody

Anti-ITPKB Antibody

Target: inositol-trisphosphate 3-kinase B
Supplier: Atlas Antibodies

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against Human ITPKB

Alternative Gene Names

  • IP3-3KB
  • IP3KB

Open Datasheet

Target Information

항목 내용
Target Protein inositol-trisphosphate 3-kinase B
Target Gene ITPKB
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000038855 (83%), Rat ENSRNOG00000002969 (82%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Antigen Sequence:
PDKPFLRKACSPSNIPAVIITDMGTQEDGALEETQGSPRGNLPLRKLSSSSASSTGFSSSYEDSEEDISSDPE

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.
  • Material Safety Data Sheet

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.