AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ITIH2 Antibody
상품 한눈에 보기
Human ITIH2 단백질을 인식하는 폴리클로날 항체로, 면역조직화학(IHC) 및 면역세포화학(ICC)에 적합합니다. Rabbit 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. Human 반응성이 검증되어 신뢰성 높은 실험 결과를 제공합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA059150-100 Anti-ITIH2 Antibody, inter-alpha-trypsin inhibitor heavy chain 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA059150-25 Anti-ITIH2 Antibody, inter-alpha-trypsin inhibitor heavy chain 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ITIH2 Antibody
Anti-ITIH2 Antibody
Target Information
- Target Protein: inter-alpha-trypsin inhibitor heavy chain 2
- Target Gene: ITIH2
- Alternative Gene Names: H2P
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human ITIH2.
Antigen Information
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
LPGAKVQFELHYQEVKWRKLGSYEHRIYLQPGRLAKHLEVDVWVIEPQGLRFLHVPDTFEGHFDGVPVISKGQQKAHVSFKPTVAQQRICPNCRET
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000001066 | 90% |
| Mouse | ENSMUSG00000037254 | 90% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 대한 최적 농도 및 조건은 사용자가 직접 확인해야 합니다.
Open Datasheet
Material Safety Data Sheet
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.