CacheBy
Atlas Antibodies Anti-ITGA7 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ITGA7 Antibody

상품 한눈에 보기

Human ITGA7 단백질을 표적으로 하는 Rabbit Polyclonal Antibody. IHC 및 ICC 응용에 적합하며, PrEST 항원을 이용해 친화 정제됨. 인간 반응성이 검증된 고품질 항체로 연구용에 최적화됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA008427-100 Anti-ITGA7 Antibody, integrin, alpha 7 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA008427-25 Anti-ITGA7 Antibody, integrin, alpha 7 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ITGA7 Antibody

Anti-ITGA7 Antibody

Target Protein: integrin, alpha 7
Target Gene: ITGA7

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human ITGA7.

Open Datasheet

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

FACPLSLEETDCYRVDIDQGADMQKESKENQWLGVSVRSQGPGGKIVTCAHRYEARQRVDQILETRDMIGRCFVLSQDLAIRDELDGGEWKFCE

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Sequence Identity
Mouse ENSMUSG00000025348 94%
Rat ENSRNOG00000007905 91%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (Sodium Azide)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.