CacheBy
Atlas Antibodies Anti-IRF2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-IRF2 Antibody

상품 한눈에 보기

인간 IRF2 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. 토끼에서 생산된 IgG 항체이며, PrEST 항원으로 친화 정제되었습니다. 인간에 반응하며 쥐와 생쥐에서도 높은 서열 유사성을 보입니다. 연구용 시약으로 안정적인 PBS/glycerol 버퍼에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA030813-100 Anti-IRF2 Antibody, interferon regulatory factor 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030813-25 Anti-IRF2 Antibody, interferon regulatory factor 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-IRF2 Antibody

Anti-IRF2 Antibody

Target Information

  • Target Protein: Interferon regulatory factor 2
  • Target Gene: IRF2
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
SLPDIEEVKDKSIKKGNNAFRVYRMLPLSERPSKKGKKPKTEKEDKVKHIKQEPVESSLGLSNGVSDLSPEYAVLTSTIKNEVDSTVNIIVVGQSHLDSNIE
  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human IRF2.

Open Datasheet

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000009824 94%
Mouse ENSMUSG00000031627 94%

Antibody Specifications

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.