CacheBy
Atlas Antibodies Anti-IPO4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-IPO4 Antibody

상품 한눈에 보기

Human IPO4 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 및 WB에 적합하며, PrEST 항원을 이용해 친화 정제됨. Human에 대한 반응성이 검증되었으며, 높은 종간 상동성을 가짐.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA039043-100 Anti-IPO4 Antibody, importin 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039043-25 Anti-IPO4 Antibody, importin 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-IPO4 Antibody

Anti-IPO4 Antibody

Target Protein: importin 4
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Validation:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal Antibody against Human IPO4

Alternative Gene Names

FLJ23338, Imp4

Open Datasheet

Target Information

항목 내용
Target Protein importin 4
Target Gene IPO4
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence AFLPYMESVFEEVFKLLECPHLNVRKAAHEALGQFCCALHKACQSCPSEPNTAALQAALARVVPSYMQAVNRERERQVVMAVLE
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000019553 (77%), Mouse ENSMUSG00000002319 (69%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
MSDS Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Application
Independent Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.