CacheBy
Atlas Antibodies Anti-IPMK Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-IPMK Antibody

상품 한눈에 보기

Human IPMK를 인식하는 Rabbit Polyclonal Antibody. Affinity purification으로 높은 특이성과 재현성 확보. ICC 등 다양한 응용에 적합. 40% glycerol 기반 PBS buffer로 안정적 보관 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA037837-100 Anti-IPMK Antibody, inositol polyphosphate multikinase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA037837-25 Anti-IPMK Antibody, inositol polyphosphate multikinase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-IPMK Antibody

Anti-IPMK Antibody

Target Information

  • Target Protein: inositol polyphosphate multikinase
  • Target Gene: IPMK
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
DCFDGVLLELRKYLPKYYGIWSPPTAPNDLYLKLEDVTHKFNKPCIMDVKIGQKSYDPFASSEKIQQQVSKYPLMEEIGFLVLGMRVYHVHSD

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000060733 (92%)
  • Rat ENSRNOG00000000609 (90%)

Product Description

Polyclonal Antibody against Human IPMK

Open Datasheet (PDF)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Recommended Applications ICC and related immunocytochemistry applications

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.
  • Material Safety Data Sheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.