CacheBy
Atlas Antibodies Anti-IP6K3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-IP6K3 Antibody

상품 한눈에 보기

Human IP6K3 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. IHPK3/INSP6K3 유전자에 대응하며, PrEST 항원으로 정제되었습니다. 인체 조직 분석 등 연구용으로 적합합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA053644-100 Anti-IP6K3 Antibody, inositol hexakisphosphate kinase 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA053644-25 Anti-IP6K3 Antibody, inositol hexakisphosphate kinase 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-IP6K3 Antibody

Anti-IP6K3 Antibody

Target: inositol hexakisphosphate kinase 3 (IP6K3)
Supplier: Atlas Antibodies

면역조직화학(IHC) 등 다양한 연구용 응용에 적합

Product Description

Polyclonal antibody against human IP6K3.

Alternative Gene Names

  • IHPK3
  • INSP6K3

Open Datasheet

Target Information

  • Protein: inositol hexakisphosphate kinase 3
  • Gene: IP6K3

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

QRFYESLPLAMKRFTPQYKGTVTVHLWKDSTGHLSLVANPVKESQEPFKVSTESAAVAIWQTLQQTTGSNGSDCTLAQWPHAQL

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Rat ENSRNOG00000025883 73%
Mouse ENSMUSG00000024210 68%

Antibody Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.