CacheBy
Atlas Antibodies Anti-INTS14 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-INTS14 Antibody

상품 한눈에 보기

Human INTS14 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. Polyclonal IgG 형태로 PrEST 항원으로 친화 정제되었으며, 사람, 마우스, 랫트에서 반응성이 검증되었습니다. 40% 글리세롤 PBS 버퍼에 보존되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA040255-100 Anti-INTS14 Antibody, integrator complex subunit 14 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040255-25 Anti-INTS14 Antibody, integrator complex subunit 14 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-INTS14 Antibody

Anti-INTS14 Antibody

Target: Integrator complex subunit 14 (INTS14)
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • WB (Western Blot) – Independent antibody validation: Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human INTS14.


Alternative Gene Names

C15orf44, DKFZP564O1664, VWA9

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Integrator complex subunit 14
Target Gene INTS14
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
LTADVQVFPRPEPFVVDEEIDPIPKVINTDLEIVGFIDIADISSPPVLSRHLVLPIALNKEGDEVGTGITDDNEDENSANQIAGKIPNFCVLLHGSLKVEGMVAIVQL
Verified Species Reactivity Human, Mouse, Rat
Interspecies Information Mouse ENSMUSG00000034263 (97%), Rat ENSRNOG00000012469 (97%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC Application
WB Independent Validation
Independent Validation Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.