CacheBy
Atlas Antibodies Anti-INTS1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-INTS1 Antibody

상품 한눈에 보기

Human INTS1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 보존성을 보입니다. 40% glycerol/PBS buffer에 보존제로 sodium azide가 포함되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA021658-100 Anti-INTS1 Antibody, integrator complex subunit 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA021658-25 Anti-INTS1 Antibody, integrator complex subunit 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-INTS1 Antibody

Anti-INTS1 Antibody

Target: integrator complex subunit 1 (INTS1)
Type: Polyclonal Antibody against Human INTS1


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Rabbit polyclonal antibody targeting the human integrator complex subunit 1 (INTS1) protein.


Alternative Gene Names

DKFZp586J0619, INT1, KIAA1440, NET28


Target Information

항목 내용
Target Protein integrator complex subunit 1
Target Gene INTS1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence LTEEEDSQTELLIAEEKLSPEQEGQLMPRYEELAESVEEYVLDMLRDQLNRRQPIDNVSRNLLRLLTSTCGYKEVRLLAVQKLEMWLQNPK

Species Reactivity

  • Verified: Human
  • Ortholog Identity:
    • Mouse (ENSMUSG00000029547): 96%
    • Rat (ENSRNOG00000022599): 96%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)


제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.