CacheBy
Atlas Antibodies Anti-INPP4A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-INPP4A Antibody

상품 한눈에 보기

Human INPP4A 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 ICC에 적합하며, PrEST 항원으로 친화 정제됨. 40% 글리세롤 기반 PBS 버퍼에 보존제로 sodium azide 포함. 인간에 대한 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA001628-100 Anti-INPP4A Antibody, inositol polyphosphate-4-phosphatase, type I, 107kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001628-25 Anti-INPP4A Antibody, inositol polyphosphate-4-phosphatase, type I, 107kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-INPP4A Antibody

Anti-INPP4A Antibody

Target: inositol polyphosphate-4-phosphatase, type I, 107kDa
Type: Polyclonal Antibody against Human INPP4A

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against human INPP4A protein.

Alternative Gene Names

  • INPP4

Open Datasheet (PDF)

Target Information

  • Target Protein: inositol polyphosphate-4-phosphatase, type I, 107kDa
  • Target Gene: INPP4A

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

SIAFFQDSLINQMTQVKLSVYDVKDRSQGTMYLLGSGTFIVKDLLQDRHHRLHLTLRSAESDRVGNITVIGWQMEEKSDQRPPVTRSVDTVNGRMVLPVDESLTEALGIRSKYASLRKDT

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000026113 96%
Rat ENSRNOG00000017660 96%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.