CacheBy
Atlas Antibodies Anti-INMT Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-INMT Antibody

상품 한눈에 보기

Human INMT 단백질을 인식하는 토끼 폴리클로날 항체로, 면역세포화학 등 다양한 연구용에 적합함. PrEST 항원으로 친화 정제되었으며, 높은 특이성과 재현성을 제공함. PBS와 글리세롤 기반 완충액에 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA061343-100 Anti-INMT Antibody, indolethylamine N-methyltransferase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA061343-25 Anti-INMT Antibody, indolethylamine N-methyltransferase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-INMT Antibody

Anti-INMT Antibody

Target Information

  • Target Protein: indolethylamine N-methyltransferase
  • Target Gene: INMT
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Epitope Sequence:
RVLKCDVHLGNPLAPAVLPLADCVLTLLAMECACCSLDAYRAALCNLASLL

Product Description

Polyclonal antibody against Human INMT.

Open Datasheet (PDF)

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to orthologs:

  • Mouse ENSMUSG00000003477 (67%)
  • Rat ENSRNOG00000011250 (67%)
  • Immunocytochemistry (ICC)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using PrEST antigen as affinity ligand

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 따른 최적 조건은 사용자가 직접 결정해야 합니다.
  • Material Safety Data Sheet (MSDS)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.