Atlas Antibodies Anti-ING2 Antibody

상품 한눈에 보기

Human ING2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 분석에 적합합니다. RNA-seq 기반 직교 검증을 통해 단백질 발현이 확인되었습니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종 간 보존성을 가집니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA021517-100 Anti-ING2 Antibody, inhibitor of growth family, member 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA021517-25 Anti-ING2 Antibody, inhibitor of growth family, member 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Inhibitor of Growth Family, Member 2 (ING2)
Supplier: Atlas Antibodies

IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data in high and low expression tissues
ICC (Immunocytochemistry)

Polyclonal antibody against Human ING2

Alternative Gene Names: ING1L, p33ING2

항목	내용
Target Protein	Inhibitor of Growth Family, Member 2
Target Gene	ING2
Antigen Sequence Type	Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence	TQMLELVENRARQMELHSQCFQDPAESERASDKAKMDSSQPERSSRRPRRQRTSESRDLCHMANGIEDCDDQPPKEKKSKSAKK
Verified Species Reactivity	Human
Interspecies Identity	Rat (96%), Mouse (95%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer Composition	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using PrEST antigen as affinity ligand
Storage/Handling	Gently mix before use. Optimal concentrations and conditions should be determined by the user.