
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ING1 Antibody
상품 한눈에 보기
Human ING1 단백질을 인식하는 rabbit polyclonal 항체. 성장 억제 단백질 연구용으로 적합하며, PrEST 항원을 이용해 친화정제됨. Human에 대한 반응성이 검증되었으며, 다양한 응용에 사용 가능.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA052591-100 Anti-ING1 Antibody, inhibitor of growth family, member 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA052591-25 Anti-ING1 Antibody, inhibitor of growth family, member 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ING1 Antibody
Anti-ING1 Antibody
개요
- Target Protein: Inhibitor of Growth Family, Member 1 (ING1)
- 제품 유형: Polyclonal Antibody against Human ING1
- 공급업체: Atlas Antibodies
Alternative Gene Names
p24ING1c, p33, p33ING1, p33ING1b, p47, p47ING1a
Recommended Applications
ICC (Immunocytochemistry)
Product Description
Polyclonal antibody recognizing human ING1 protein, part of the inhibitor of growth (ING) family involved in cell cycle regulation and apoptosis.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Inhibitor of growth family, member 1 |
| Target Gene | ING1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (78%), Rat (77%) |
Antigen Sequence:
VELFEAQQELGDTAGNSGKAGADRPKGEAAAQADKPNSKRSRRQRNNENRENASSNHDHDDGASGTPKEKKAKTSKKK
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2)
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet (MSDS)
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 맞는 최적의 농도와 조건은 사용자가 직접 확인해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



