CacheBy
Atlas Antibodies Anti-IMPG1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-IMPG1 Antibody

상품 한눈에 보기

Human IMPG1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 단백질 발현 검증에 사용 가능. PrEST 항원으로 친화 정제되었으며, 인간에 대해 검증 완료. 40% 글리세롤/PBS 완충액에 보존제로 sodium azide 포함.

카탈로그번호
HPA027142-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA027142-100 Anti-IMPG1 Antibody, interphotoreceptor matrix proteoglycan 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027142-25 Anti-IMPG1 Antibody, interphotoreceptor matrix proteoglycan 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-IMPG1 Antibody

Anti-IMPG1 Antibody

Target: interphotoreceptor matrix proteoglycan 1 (IMPG1)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
    Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal antibody against Human IMPG1.


Alternative Gene Names

  • GP147
  • IPM150
  • SPACR

Open Datasheet (PDF)


Specifications

항목 내용
Target Protein interphotoreceptor matrix proteoglycan 1
Target Gene IMPG1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence NERTEEAECRCKPGYDSQGSLDGLEPGLCGPGTKECEVLQGKGAPCRLPDHSENQAYKTSVKKFQNQQNNKVISKRNSELLTVEYEEFNHQDWEGN
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000012479 (60%), Mouse ENSMUSG00000032343 (54%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.
  • Material Safety Data Sheet

제품 이미지

Enhanced Validation
IHC Independent Validation
Tooltip Independent Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.