Atlas Antibodies Anti-IMPG1 Antibody

상품 한눈에 보기

Human IMPG1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 단백질 발현 검증에 사용 가능. PrEST 항원으로 친화 정제되었으며, 인간에 대해 검증 완료. 40% 글리세롤/PBS 완충액에 보존제로 sodium azide 포함.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA027142-100 Anti-IMPG1 Antibody, interphotoreceptor matrix proteoglycan 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA027142-25 Anti-IMPG1 Antibody, interphotoreceptor matrix proteoglycan 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: interphotoreceptor matrix proteoglycan 1 (IMPG1)
Supplier: Atlas Antibodies

Immunohistochemistry (IHC)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Polyclonal antibody against Human IMPG1.

항목	내용
Target Protein	interphotoreceptor matrix proteoglycan 1
Target Gene	IMPG1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	NERTEEAECRCKPGYDSQGSLDGLEPGLCGPGTKECEVLQGKGAPCRLPDHSENQAYKTSVKKFQNQQNNKVISKRNSELLTVEYEEFNHQDWEGN
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000012479 (60%), Mouse ENSMUSG00000032343 (54%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand