Atlas Antibodies Anti-ILDR1 Antibody

상품 한눈에 보기

인간 ILDR1 단백질을 표적으로 하는 폴리클로날 항체. 토끼에서 생산된 IgG 형식으로 IHC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. 40% 글리세롤 및 PBS 완충액에 보존.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA018207-100 Anti-ILDR1 Antibody, immunoglobulin-like domain containing receptor 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA018207-25 Anti-ILDR1 Antibody, immunoglobulin-like domain containing receptor 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: immunoglobulin-like domain containing receptor 1 (ILDR1)

Polyclonal antibody against human ILDR1.

항목	내용
Target Protein	immunoglobulin-like domain containing receptor 1
Target Gene	ILDR1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence Detail	LEYLEKELRNLNLAQPLPPDLKGRFGHPCSMLSSLGSEVVERRIIHLPPLIRDLSSSRRTSDSLHQQWLTPIPSRPWDLREGRSHHHYPDFHQELQDRGPKSWALERRELDPSWSGRHRSSRLNGSPIHWSDRDSLSDVPS

Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet