CacheBy
Atlas Antibodies Anti-IL4R Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-IL4R Antibody

상품 한눈에 보기

Human IL4R을 인식하는 Rabbit Polyclonal Antibody로 다양한 연구 응용에 적합. Affinity purification으로 높은 특이성 확보. CD124로도 알려진 interleukin 4 receptor 타깃. 인체 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA070380-100 Anti-IL4R Antibody, interleukin 4 receptor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA070380-25 Anti-IL4R Antibody, interleukin 4 receptor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-IL4R Antibody

Anti-IL4R Antibody

Target Information

  • Target Protein: Interleukin 4 receptor
  • Target Gene: IL4R
  • Alternative Gene Names: CD124

면역세포 염색(ICC) 등 다양한 연구 응용에 적합

Product Description

Polyclonal Antibody against Human IL4R

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

DNLTCTETPLVIAGNPAYRSFSNSLSQSPCPRELGPDPLLARHLEEVEPEMPCVPQLSEPTTVPQPEPETWEQILRRNVLQHGAAAAPVSAPTSGYQEFV

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Sequence Identity
Mouse ENSMUSG00000030748 55%
Rat ENSRNOG00000015441 51%

Product Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 사용자가 직접 결정해야 합니다.

Reference

Open Datasheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.