CacheBy
Atlas Antibodies Anti-IL33 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-IL33 Antibody

상품 한눈에 보기

Human IL33를 인식하는 Rabbit Polyclonal Antibody로, WB 및 ICC에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. Human에 반응하며 Rat, Mouse와 부분적 교차 반응성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA024426-100 Anti-IL33 Antibody, interleukin 33 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA024426-25 Anti-IL33 Antibody, interleukin 33 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-IL33 Antibody

Anti-IL33 Antibody

Target Information

  • Target Protein: Interleukin 33
  • Target Gene: IL33
  • Alternative Gene Names: C9orf26, DKFZp586H0523, DVS27, IL1F11, NF-HEV
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human IL33

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

MVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKL

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Rat ENSRNOG00000016456 57%
Mouse ENSMUSG00000024810 56%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Storage Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Material Safety Data Sheet (MSDS)
Open Datasheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.