
원본
Thermo Fisher Scientific NHLH2 Monoclonal Antibody (3D5)
상품 한눈에 보기
NHLH2 단백질을 인식하는 Thermo Fisher Scientific의 mouse monoclonal antibody (clone 3D5). Western blot, ICC/IF, ELISA에 사용 가능하며, 인간 시료 반응성. Affinity chromatography로 정제된 액상 형태, 보존제 없음, -20°C 보관.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오후 05:27
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific H00004808-M02 NHLH2 Monoclonal Antibody (3D5) 100 ug pk판매 단위 pk ·
재고 확인 필요
518,100원VAT 포함 569,910원
Thermo Fisher Scientific · Thermo Fisher Scientific NHLH2 Monoclonal Antibody (3D5)
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1–5 µg/mL |
| Immunocytochemistry (ICC/IF) | 10 µg/mL |
| ELISA | 1 ng/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Mouse / IgG2a, kappa |
| Class | Monoclonal |
| Type | Antibody |
| Clone | 3D5 |
| Immunogen | NHLH2 (NP_005590, 36 a.a. approximately 135 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 kDa. |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | See Label |
| Purification | Affinity chromatography |
| Storage Buffer | PBS, pH 7.4 |
| Contains | No preservative |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
Product Specific Information
Sequence of this protein is as follows:
SDLEPVEEAEGDGKGGSRAALYPHPQQLSREEKRRRRRATAKYRSAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV
Target Information
May serve as a DNA-binding protein and may be involved in the control of cell-type determination, possibly within the developing nervous system.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
