CacheBy
Thermo Fisher Scientific NHLH2 Monoclonal Antibody (3D5)
원본

Thermo Fisher Scientific NHLH2 Monoclonal Antibody (3D5)

상품 한눈에 보기

NHLH2 단백질을 인식하는 Thermo Fisher Scientific의 mouse monoclonal antibody (clone 3D5). Western blot, ICC/IF, ELISA에 사용 가능하며, 인간 시료 반응성. Affinity chromatography로 정제된 액상 형태, 보존제 없음, -20°C 보관.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오후 05:27
Thermo Fisher Scientific H00004808-M02 NHLH2 Monoclonal Antibody (3D5) 100 ug pk판매 단위 pk ·
재고 확인 필요
518,100원VAT 포함 569,910원

Thermo Fisher Scientific · Thermo Fisher Scientific NHLH2 Monoclonal Antibody (3D5)

Applications and Tested Dilutions

Application Tested Dilution
Western Blot (WB) 1–5 µg/mL
Immunocytochemistry (ICC/IF) 10 µg/mL
ELISA 1 ng/mL

Product Specifications

항목 내용
Species Reactivity Human
Host / Isotype Mouse / IgG2a, kappa
Class Monoclonal
Type Antibody
Clone 3D5
Immunogen NHLH2 (NP_005590, 36 a.a. approximately 135 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Conjugate Unconjugated
Form Liquid
Concentration See Label
Purification Affinity chromatography
Storage Buffer PBS, pH 7.4
Contains No preservative
Storage Conditions -20°C, Avoid Freeze/Thaw Cycles
Shipping Conditions Ambient (domestic); Wet ice (international)

Product Specific Information

Sequence of this protein is as follows:
SDLEPVEEAEGDGKGGSRAALYPHPQQLSREEKRRRRRATAKYRSAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV

Target Information

May serve as a DNA-binding protein and may be involved in the control of cell-type determination, possibly within the developing nervous system.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.