CacheBy
Atlas Antibodies Anti-ZNF830 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZNF830 Antibody

상품 한눈에 보기

인간 ZNF830 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 독립 항체 비교를 통한 검증으로 높은 신뢰성을 제공합니다. Human, Mouse, Rat 반응성이 확인되었습니다.

카탈로그번호
HPA027211-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA027211-100 Anti-ZNF830 Antibody, zinc finger protein 830 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027211-25 Anti-ZNF830 Antibody, zinc finger protein 830 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZNF830 Antibody

Anti-ZNF830 Antibody

Target: Zinc Finger Protein 830
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry) – Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Western Blot) – Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human ZNF830.


Alternative Gene Names

CCDC16, MGC20398, OMCG1


Target Information

항목 내용
Target Protein Zinc Finger Protein 830
Target Gene ZNF830
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human, Mouse, Rat
Interspecies Sequence Identity Mouse (88%), Rat (87%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Antigen Sequence

QGKEHSVSSSREVTSSVLPNDFFSTNPPKAPIIPHSGSIEKAEIHEKVVERRENTAEALPEGFFDDPEVDARVRKVDAPKDQM

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.
  • Material Safety Data Sheet

Additional Resources

Open Datasheet (PDF)


제품 이미지

Enhanced Validation
IHC Validation
WB Validation
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.