CacheBy
Atlas Antibodies Anti-ZNF776 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZNF776 Antibody

상품 한눈에 보기

인간 ZNF776 단백질을 인식하는 폴리클로날 항체로 IHC 및 ICC에 적합합니다. Rabbit에서 생산된 IgG 형식이며, PrEST 항원으로 친화 정제되었습니다. 인간 반응성이 검증되었으며, FLJ38288 대체 유전자명으로도 알려져 있습니다.

카탈로그번호
HPA046653-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA046653-100 Anti-ZNF776 Antibody, zinc finger protein 776 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046653-25 Anti-ZNF776 Antibody, zinc finger protein 776 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZNF776 Antibody

Anti-ZNF776 Antibody

Target Information

  • Target Protein: Zinc finger protein 776
  • Target Gene: ZNF776
  • Alternative Gene Names: FLJ38288
  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human ZNF776

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

LLQQEDIHTSGKSNFETKHGIPLQGGKTHYICGESTIPFSNKHSLVLHQRLLPREGPYVCSDSGKFTSKS

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000062040 (38%)
  • Rat ENSRNOG00000047627 (38%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Verified Species Reactivity Human

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Material Safety Data Sheet
Open Datasheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.