CacheBy
Atlas Antibodies Anti-ZNF662 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZNF662 Antibody

상품 한눈에 보기

Human ZNF662 단백질을 인식하는 rabbit polyclonal 항체. IHC 및 WB에 적합하며, PrEST 항원을 이용해 친화 정제됨. 높은 특이성과 재현성을 제공하며, 다양한 연구 응용에 활용 가능.

카탈로그번호
HPA039116-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA039116-100 Anti-ZNF662 Antibody, zinc finger protein 662 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039116-25 Anti-ZNF662 Antibody, zinc finger protein 662 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZNF662 Antibody

Anti-ZNF662 Antibody

Target: Zinc finger protein 662 (ZNF662)
Type: Polyclonal antibody against Human ZNF662


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody raised in rabbit against human zinc finger protein 662 (ZNF662).


Alternative Gene Names

  • FLJ45880

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Zinc finger protein 662
Target Gene ZNF662
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence SQELWFGKTCEEKSRLGRWPGYLNGGRMESSTNDIIEVIVKDEMISVEESSGNTDVNNLLGIHHKILNEQI

Verified Species Reactivity

  • Human

Interspecies Information

Ortholog ID Sequence Identity
Rat ENSRNOG00000010744 25%
Mouse ENSMUSG00000026674 25%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.