CacheBy
Atlas Antibodies Anti-ZNF648 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZNF648 Antibody

상품 한눈에 보기

Human ZNF648 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. 40% 글리세롤 기반 버퍼에 보관됩니다.

카탈로그번호
HPA053897-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA053897-100 Anti-ZNF648 Antibody, zinc finger protein 648 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA053897-25 Anti-ZNF648 Antibody, zinc finger protein 648 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZNF648 Antibody

Anti-ZNF648 Antibody

Target Protein: zinc finger protein 648
Alternative Gene Names: FLJ46813

  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human ZNF648.

Target Information

항목 내용
Target Protein zinc finger protein 648
Target Gene ZNF648
Alternative Gene Names FLJ46813
Verified Species Reactivity Human
Interspecies Identity Mouse (41%), Rat (38%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

DVPPSFPSNGKYLCAHKSVDTSAGNSSLLCFPRPGSNWDLPTQETHTPAQASATPASLAAAVLAKARNSRKVQ

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.
  • Open Datasheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.