
1 / 2
Atlas Antibodies Anti-ZNF627 Antibody
상품 한눈에 보기
Human ZNF627 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 IHC 분석에 적합합니다. PrEST 항원으로 친화 정제되었으며, 40% 글리세롤 및 PBS 완충액에 보존되어 있습니다. 인간에 대해 검증된 반응성을 보입니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ZNF627 Antibody
Target Protein: Zinc finger protein 627
Gene Symbol: ZNF627 (Alternative name: FLJ90365)
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against human ZNF627, generated in rabbit and affinity purified using the PrEST antigen as affinity ligand.
Antigen Information
Antigen Sequence:
RHIRDHTGREPNEYQEYGKKSYTRNQCGRALSYHRSFPVRERTHPGGKP
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
Verified Species Reactivity
- Human
Interspecies Identity:
- Rat (ENSRNOG00000000891): 45%
- Mouse (ENSMUSG00000109771): 44%
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol, PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Storage | Store at -20°C; avoid repeated freeze-thaw cycles |
| Safety | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ZNF627 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF630 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF627 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF625 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF624 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.