
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ZNF621 Antibody
상품 한눈에 보기
Human ZNF621을 인식하는 토끼 폴리클로날 항체로, zinc finger protein 621 타깃 검출에 적합. Affinity purification 방식으로 높은 특이성과 재현성 제공. ICC 등 다양한 응용에 사용 가능. 40% 글리세롤 및 PBS 버퍼로 안정화.
- 카탈로그번호
- HPA065518-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA065518-100 Anti-ZNF621 Antibody, zinc finger protein 621 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA065518-25 Anti-ZNF621 Antibody, zinc finger protein 621 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ZNF621 Antibody
Anti-ZNF621 Antibody
Target: Zinc finger protein 621
Host Species: Rabbit
Clonality: Polyclonal
Supplier: Atlas Antibodies
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human ZNF621 (zinc finger protein 621).
Alternative Gene Names
- FLJ45246
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Zinc finger protein 621 |
| Target Gene | ZNF621 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | RGISQGGESWIKNEGLVIKQEASEETELHRMPVGGLLRNVSQHFDFKRKALKQTFNLNPNL |
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000029761 | 26% |
| Rat | ENSRNOG00000010233 | 26% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet (MSDS)
Notes
Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



