CacheBy
Atlas Antibodies Anti-ZNF594 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZNF594 Antibody

상품 한눈에 보기

Human ZNF594 단백질을 인식하는 rabbit polyclonal 항체로, ICC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화정제 방식으로 높은 특이성과 재현성을 제공. Human에 대해 검증됨.

카탈로그번호
HPA074493-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA074493-100 Anti-ZNF594 Antibody, zinc finger protein 594 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA074493-25 Anti-ZNF594 Antibody, zinc finger protein 594 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZNF594 Antibody

Anti-ZNF594 Antibody

Target Protein: zinc finger protein 594
Alternative Gene Name: KIAA1871

Product Description

Polyclonal antibody against human ZNF594. Produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.

  • ICC (Immunocytochemistry)

Target Information

항목 내용
Target Protein zinc finger protein 594
Target Gene ZNF594
Alternative Gene Name KIAA1871
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000053297 (33%), Rat ENSRNOG00000053518 (31%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

IREMHIIPQKAIVGEIGHGCNEGEKILSAGESSHRYEVSGQNFKQKSGLTEHQK

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2)
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference

Open Datasheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.