AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ZNF561 Antibody
상품 한눈에 보기
Human ZNF561 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 연구 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. PBS/glycerol 완충액에 보존되어 안정적 사용 가능.
- 카탈로그번호
- HPA062397-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA062397-100 Anti-ZNF561 Antibody, zinc finger protein 561 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA062397-25 Anti-ZNF561 Antibody, zinc finger protein 561 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ZNF561 Antibody
Anti-ZNF561 Antibody
Target: Zinc finger protein 561 (ZNF561)
Supplier: Atlas Antibodies
Catalog: HPA055332
Product Description
Polyclonal antibody against human ZNF561 (zinc finger protein 561).
Produced in rabbit and affinity purified using the PrEST antigen.
Recommended Applications
- Immunohistochemistry (IHC)
Alternative Gene Names
- MGC45408
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Zinc finger protein 561 |
| Target Gene | ZNF561 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | SVHKEASTGQELSKFNPCGKVFTLTPGLAVHLEVLN |
Species Reactivity
Verified species: Human
Interspecies Information:
Highest antigen sequence identity with:
- Mouse ENSMUSG00000060510 (44%)
- Rat ENSRNOG00000034037 (44%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.