CacheBy
Atlas Antibodies Anti-ZNF517 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZNF517 Antibody

상품 한눈에 보기

Human ZNF517 단백질을 인식하는 Rabbit Polyclonal 항체로, PrEST 항원을 이용해 친화 정제됨. ICC 등 다양한 응용에 적합하며, 40% 글리세롤 기반 PBS 버퍼에 보존됨. 인간에 대한 반응성이 검증됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA055337-100 Anti-ZNF517 Antibody, zinc finger protein 517 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055337-25 Anti-ZNF517 Antibody, zinc finger protein 517 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZNF517 Antibody

Anti-ZNF517 Antibody

Target: Zinc finger protein 517 (ZNF517)
Type: Polyclonal Antibody against Human ZNF517

  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody raised in rabbit against human zinc finger protein 517 (ZNF517).
Affinity purified using the PrEST antigen as affinity ligand.

Open Datasheet (PDF)

Target Information

  • Target Protein: Zinc finger protein 517
  • Target Gene: ZNF517
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    RCGQRFIRGSSLLKHHRLHAQEGAQDGGAGQGALLGAAQRPQAGDPPHECPVCGRPFRHNSLLLL

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Sequence Identity
Mouse ENSMUSG00000004500 41%
Rat ENSRNOG00000027436 41%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.