CacheBy
Atlas Antibodies Anti-ZNF419 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZNF419 Antibody

상품 한눈에 보기

Human ZNF419 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화도 정제됨. 인체 반응성 검증 완료. 40% glycerol/PBS 버퍼에 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA003274-100 Anti-ZNF419 Antibody, zinc finger protein 419 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA003274-25 Anti-ZNF419 Antibody, zinc finger protein 419 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZNF419 Antibody

Anti-ZNF419 Antibody

Target Protein: Zinc finger protein 419
Target Gene: ZNF419
Alternative Gene Names: ZNF419A

  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human ZNF419, generated in rabbit and affinity purified using the PrEST antigen as affinity ligand.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
RLLDDAQRLLYRNVMLENFTLLASLGCWHGAEAEEAPEQIASVGLLSSNIQQHQKQHCGEKPLKRQEGRVPV

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to orthologs:

  • Rat (ENSRNOG00000055843): 41%
  • Mouse (ENSMUSG00000063535): 35%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol, PBS (pH 7.2), 0.02% sodium azide
Purification Method Affinity purified using PrEST antigen
Storage Note Gently mix before use. Optimal conditions should be determined by the user.

Reference Documents

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.