CacheBy
Atlas Antibodies Anti-ZNF367 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZNF367 Antibody

상품 한눈에 보기

Human ZNF367 단백질을 인식하는 토끼 폴리클로날 항체로, 면역세포화학 등 다양한 응용에 적합합니다. PrEST 항원으로 특이적 정제되었으며, 높은 종간 보존성을 보입니다. PBS/glycerol 완충액에 보존제로 sodium azide가 포함되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA015319-100 Anti-ZNF367 Antibody, zinc finger protein 367 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA015319-25 Anti-ZNF367 Antibody, zinc finger protein 367 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZNF367 Antibody

Anti-ZNF367 Antibody

Target Information

  • Target Protein: Zinc finger protein 367
  • Target Gene: ZNF367
  • Alternative Gene Names: FLJ33970

Product Description

Polyclonal antibody against human ZNF367.

  • Immunocytochemistry (ICC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

RHCPKHPYARLKREEPTDTLSKHQAADNKAAAEWLARYWEMREQRTPTLKGKLVQKADQEQQDPLEYLQSDEEDDEKRGAQRRLQEQRERLHGALALIELANLTG

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat (ENSRNOG00000027234): 96%
  • Mouse (ENSMUSG00000044934): 95%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

제품 이미지

Recommended Applications: ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.