CacheBy
Atlas Antibodies Anti-ZNF354A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZNF354A Antibody

상품 한눈에 보기

인간 ZNF354A 단백질을 타겟으로 하는 폴리클로날 항체. IHC 및 ICC 등 다양한 응용에 적합. 토끼 유래 IgG 형식으로 높은 특이성과 재현성을 제공. PrEST 항원으로 친화 정제되어 안정적 성능 보장.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA052043-100 Anti-ZNF354A Antibody, zinc finger protein 354A 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA052043-25 Anti-ZNF354A Antibody, zinc finger protein 354A 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZNF354A Antibody

Anti-ZNF354A Antibody

Target Information

  • Target Protein: Zinc finger protein 354A
  • Target Gene: ZNF354A
  • Alternative Gene Names: EZNF, HKL1, KID-1, KID1, TCF17

Product Description

Polyclonal antibody against human ZNF354A.

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

TQDSSFQGLILKRSNRNVPWDLKLEKPYIYEGRLEKKQDKKGSFQIVSATHKKIPTIERSHKNTELSQNFSPKSVLIRQQILPR

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Sequence Identity
Mouse ENSMUSG00000020364 40%
Rat ENSRNOG00000003634 40%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.