AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ZNF322 Antibody
상품 한눈에 보기
인체 ZNF322 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB에 적합하며, PrEST 항원을 이용해 친화 정제됨. 40% 글리세롤/PBS 완충액에 보존제로 아지드 함유. 사람에 특이적이며 쥐, 생쥐와 91% 상동성.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA043161-100 Anti-ZNF322 Antibody, zinc finger protein 322 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043161-25 Anti-ZNF322 Antibody, zinc finger protein 322 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ZNF322 Antibody
Anti-ZNF322 Antibody
Target: Zinc finger protein 322 (ZNF322)
Type: Polyclonal antibody against human ZNF322
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against human ZNF322, a zinc finger protein. Suitable for use in IHC and WB applications.
Alternative Gene Names
bA457M11.2, bA457M11.3, HCG12, ZNF322A, ZNF388, ZNF489
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
QRIHMEEKPHQWSACESGFLLGMDFVAQQKMRTQTEELHYKYTVCD
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000017318 | 91% |
| Mouse | ENSMUSG00000046351 | 91% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.