
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ZNF280C Antibody
상품 한눈에 보기
Human ZNF280C 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 분석에 적합합니다. Orthogonal validation으로 RNA-seq 데이터와 비교 검증되었습니다. Rabbit에서 생산된 IgG 항체로, PrEST 항원을 이용해 친화 정제되었습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA051494-100 Anti-ZNF280C Antibody, zinc finger protein 280C 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051494-25 Anti-ZNF280C Antibody, zinc finger protein 280C 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ZNF280C Antibody
Anti-ZNF280C Antibody
Target: zinc finger protein 280C
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data in high and low expression tissues.
- WB (Western Blot)
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human ZNF280C.
Alternative Gene Names
FLJ20095, SUHW3, ZNF633
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | zinc finger protein 280C |
| Target Gene | ZNF280C |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | VSKSSQSSVTVENASKPDFTKNSQVGSDNSSILLFDSTQESLPPSQDIPAIFREGMKNTSYVLKHPSTSKVNSVTPKKPKTSEDV |
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000036916 | 50% |
| Rat | ENSRNOG00000006797 | 47% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



