CacheBy
Atlas Antibodies Anti-ZNF142 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZNF142 Antibody

상품 한눈에 보기

인간 ZNF142 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 ICC에 적합하며, PrEST 항원으로 친화 정제됨. 인간에 특이적으로 반응하고, 쥐 및 생쥐와 94% 서열 동일성을 가짐. 40% 글리세롤/PBS 완충액에 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA049594-100 Anti-ZNF142 Antibody, zinc finger protein 142 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049594-25 Anti-ZNF142 Antibody, zinc finger protein 142 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZNF142 Antibody

Anti-ZNF142 Antibody

Target Information

  • Target Protein: Zinc finger protein 142
  • Target Gene: ZNF142
  • Alternative Gene Names: KIAA0236, pHZ-49

Product Description

Polyclonal antibody against human ZNF142.
Produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

RHQGKSLMCEVCAFACKRKYELQKHMASQHHPGTPSPLYPCHYCSYQSRHKQAVLSHENCKHTRLREFHCALCDYRTFSNTTLL

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000022414 (94%)
  • Mouse ENSMUSG00000026135 (94%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Storage Notes Gently mix before use. Determine optimal concentrations and conditions experimentally.

Reference Documents

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.