CacheBy
Atlas Antibodies Anti-ZNF114 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZNF114 Antibody

상품 한눈에 보기

Human ZNF114 단백질을 인식하는 Rabbit Polyclonal 항체. IHC, WB, ICC에 적합하며, PrEST 항원을 이용해 친화 정제됨. 40% glycerol/PBS buffer에 보존되어 안정적이며, 다양한 연구용 응용에 사용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA029553-100 Anti-ZNF114 Antibody, zinc finger protein 114 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029553-25 Anti-ZNF114 Antibody, zinc finger protein 114 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZNF114 Antibody

Anti-ZNF114 Antibody

Target Information

  • Target Protein: Zinc finger protein 114
  • Target Gene: ZNF114
  • Alternative Gene Names: MGC17986

Product Description

Polyclonal antibody against human ZNF114, developed in rabbit and affinity purified using the PrEST antigen as ligand.

  • IHC (Immunohistochemistry)
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

LPKRTFPEANRVCLTSISSQHSTLREDWRCPKTEEPHRQGVNNVKPPAVAPEKDESPVSICEDHEMRNHSKPTC

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000031208 (28%)
  • Mouse ENSMUSG00000033722 (26%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method Affinity purified using PrEST antigen
Storage Gently mix before use. Store according to supplier’s instructions.

Material Safety Data Sheet (MSDS)
Open Datasheet (PDF)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.