AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ZIM3 Antibody
상품 한눈에 보기
인간 ZIM3 단백질을 인식하는 토끼 폴리클로날 항체. 면역조직화학(IHC) 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제됨. ZNF657로도 알려진 ZIM3 유전자 타깃. 글리세롤 및 PBS 완충액에 보존제 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA034575-100 Anti-ZIM3 Antibody, zinc finger, imprinted 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA034575-25 Anti-ZIM3 Antibody, zinc finger, imprinted 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ZIM3 Antibody
Anti-ZIM3 Antibody
Target: zinc finger, imprinted 3 (ZIM3, also known as ZNF657)
Type: Polyclonal Antibody against Human ZIM3
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody produced in rabbit, targeting the human ZIM3 protein.
Affinity purified using the PrEST antigen as affinity ligand.
Alternative Gene Names
- ZNF657
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | zinc finger, imprinted 3 |
| Target Gene | ZIM3 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | NYSNLVSVGQGETTKPDVILRLEQGKEPWLEEEEVLGSGRAEKNGDIGGQIWKPKDVKESLAREVPSINKETLTTQKGVECDGSKK |
Verified Species Reactivity
- Human
Interspecies Information:
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000046338 (35%)
- Mouse ENSMUSG00000020335 (33%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.