CacheBy
Atlas Antibodies Anti-ZHX2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZHX2 Antibody

상품 한눈에 보기

인간 ZHX2 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC에 적합합니다. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공합니다. 토끼 유래 IgG 형식이며 PBS-글리세롤 완충액에 보존되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA006996-100 Anti-ZHX2 Antibody, zinc fingers and homeoboxes 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA006996-25 Anti-ZHX2 Antibody, zinc fingers and homeoboxes 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZHX2 Antibody

Anti-ZHX2 Antibody

Target: Zinc fingers and homeoboxes 2 (ZHX2)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC) – Independent antibody validation
    Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human ZHX2.


Alternative Gene Names

  • KIAA0854

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Zinc fingers and homeoboxes 2
Target Gene ZHX2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000071757 (86%), Rat ENSRNOG00000005417 (85%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Antigen Sequence

KYDSLSDHNSKFHPGEANFKLKLIKRNNQTVLEQSIETTNHVVSITTSGPGTGDSDSGISVSKTPIMKPGKPKADAKKVPKKPEEITPENHVEGTARLVTDTAEILSRLGGVELLQDTLGHVMPSVQLPPNINLVPKVPVPLNTTKYNSA

제품 이미지

Enhanced Validation
IHC Independent
Independent Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.