CacheBy
Atlas Antibodies Anti-ZHX1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZHX1 Antibody

상품 한눈에 보기

Human ZHX1 단백질을 인식하는 Rabbit Polyclonal 항체로, Affinity purification 방식으로 정제됨. ICC 등 다양한 응용에 적합하며, 40% glycerol/PBS buffer로 안정화. 인간 및 설치류 종에 높은 교차 반응성을 보임.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA055357-100 Anti-ZHX1 Antibody, zinc fingers and homeoboxes 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055357-25 Anti-ZHX1 Antibody, zinc fingers and homeoboxes 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZHX1 Antibody

Anti-ZHX1 Antibody

Target Information

  • Target Protein: Zinc fingers and homeoboxes 1
  • Target Gene: ZHX1
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Epitope Sequence:
    KEEKMEIDESNAGSSKEEAGETSPADESGAPKSGSTGKICKKTPEQLHMLKSAFVRTQWPSPEEYDKLAKESG

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000022361) – 84%
  • Rat (ENSRNOG00000006412) – 84%
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human ZHX1.

Open Datasheet

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 사용자가 실험 목적에 따라 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.