CacheBy
Atlas Antibodies Anti-ZFAND6 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZFAND6 Antibody

상품 한눈에 보기

인간 ZFAND6 단백질을 인식하는 폴리클로날 항체입니다. Rabbit 호스트에서 생산되었으며 IgG 아이소타입입니다. IHC와 WB 실험에 적합하며, PrEST 항원으로 친화 정제되었습니다. 인간에 대한 반응성이 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA034845-100 Anti-ZFAND6 Antibody, zinc finger, AN1-type domain 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA034845-25 Anti-ZFAND6 Antibody, zinc finger, AN1-type domain 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZFAND6 Antibody

Anti-ZFAND6 Antibody

Target: zinc finger, AN1-type domain 6
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal Antibody against Human ZFAND6


Alternative Gene Names

AWP1, ZA20D3, ZFAND5B

Open Datasheet


Antigen Information

Target Protein: zinc finger, AN1-type domain 6
Target Gene: ZFAND6
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

SSNGRISPPATSVSSLSESLPVQCTDGSVPEAQSALDSTSSSMQPSPVSNQSLLSESVASSQLDSTSVDK

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000013506 91%
Mouse ENSMUSG00000030629 91%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.