CacheBy
Atlas Antibodies Anti-ZFAND2B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZFAND2B Antibody

상품 한눈에 보기

인간 ZFAND2B 단백질을 표적으로 하는 폴리클로날 항체입니다. IHC 및 WB 응용에 적합하며, 토끼에서 생산된 IgG 형입니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 서열 일치도를 보입니다. AIRAPL 유전자의 연구용으로 권장됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA035160-100 Anti-ZFAND2B Antibody, zinc finger, AN1-type domain 2B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035160-25 Anti-ZFAND2B Antibody, zinc finger, AN1-type domain 2B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZFAND2B Antibody

Anti-ZFAND2B Antibody

Target Protein: zinc finger, AN1-type domain 2B
Alternative Gene Names: AIRAPL
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human ZFAND2B.

Target Information

항목 내용
Target Protein zinc finger, AN1-type domain 2B
Target Gene ZFAND2B
Alternative Gene Names AIRAPL
Verified Species Reactivity Human
Interspecies Sequence Identity Rat (91%), Mouse (89%)

Antigen Information

Antigen Sequence (PrEST antigen):
NGLSEDEALQRALEMSLAETKPQVPSCQEEEDLALAQALSASEAEYQRQQAQSRSSKPSNCSLC

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.