원본

Atlas Antibodies Anti-ZDHHC4 Antibody

상품 한눈에 보기

Human ZDHHC4 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB 실험에 적합합니다. Rabbit 유래 IgG 형식이며, PrEST 항원으로 정제되었습니다. PBS와 글리세롤 버퍼에 보존되어 안정적인 사용이 가능합니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA032124-100 Anti-ZDHHC4 Antibody, zinc finger, DHHC-type containing 4 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA032124-25 Anti-ZDHHC4 Antibody, zinc finger, DHHC-type containing 4 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: zinc finger, DHHC-type containing 4
Supplier: Atlas Antibodies

Polyclonal antibody against human ZDHHC4.

항목	내용
Target Gene	ZDHHC4
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000051699 (74%), Mouse ENSMUSG00000001844 (74%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method	Affinity purified using PrEST antigen as affinity ligand

TNQTTNEWYRGDWAWCQRCPLVAWPPSAEPQVHRNIHSHGLRSNLQEIFLPAFPCHERKKQE

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.

IHC Application
WB Application

0개

로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.