CacheBy
Atlas Antibodies Anti-ZDBF2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZDBF2 Antibody

상품 한눈에 보기

Human ZDBF2 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, 고순도 IgG 형태로 제공. 인간에 대한 반응성이 검증됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA050311-100 Anti-ZDBF2 Antibody, zinc finger, DBF-type containing 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050311-25 Anti-ZDBF2 Antibody, zinc finger, DBF-type containing 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZDBF2 Antibody

Anti-ZDBF2 Antibody

Target: zinc finger, DBF-type containing 2 (ZDBF2)
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human ZDBF2 protein.

Alternative Gene Names

FLJ45338, KIAA1571

Open Datasheet (PDF)

Antigen Information

  • Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    TDMPSNKGIFEDTIAKNHEEFFSNMDCTQEEKHLVFNKTAFWEQKCSVSSEMKFDCISLQSASDQPQETAQDLSLWKEEQIDQEDNYE

Verified Species Reactivity

Human

Interspecies Information

Species Ortholog ID Sequence Identity
Rat ENSRNOG00000024114 43%
Mouse ENSMUSG00000027520 38%

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet

Purification Method

Affinity purified using the PrEST antigen as affinity ligand.

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.