CacheBy
Atlas Antibodies Anti-ZBTB25 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZBTB25 Antibody

상품 한눈에 보기

Human ZBTB25 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC에 적합합니다. Rabbit에서 생산된 IgG 항체이며, PrEST 항원을 이용한 친화 정제 방식으로 고순도 확보. 인간에 대한 반응성 검증 완료.

카탈로그번호
HPA054699-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA054699-100 Anti-ZBTB25 Antibody, zinc finger and BTB domain containing 25 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA054699-25 Anti-ZBTB25 Antibody, zinc finger and BTB domain containing 25 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZBTB25 Antibody

Anti-ZBTB25 Antibody

Target: Zinc finger and BTB domain containing 25
Type: Polyclonal antibody against Human ZBTB25

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody targeting human ZBTB25 protein.

Alternative Gene Names

  • C14orf51
  • KUP
  • ZNF46

Open Datasheet

Target Information

  • Target Protein: Zinc finger and BTB domain containing 25
  • Target Gene: ZBTB25

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

IGLDDGTADQQRACPATQALEEHQKPPVSIKQERCDPESVISQSHPSPSSEVTGPTFTENSVKIHLCHYCGERFDSRSNLR

Verified Species Reactivity

  • Human

Interspecies Information

Species Ortholog ID Sequence Identity
Rat ENSRNOG00000006441 86%
Mouse ENSMUSG00000056459 84%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.