CacheBy
Atlas Antibodies Anti-ZBTB25 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZBTB25 Antibody

상품 한눈에 보기

Human ZBTB25 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC에 적합합니다. Rabbit에서 생산된 IgG 항체이며, PrEST 항원을 이용한 친화 정제 방식으로 고순도 확보. 인간에 대한 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA054699-100 Anti-ZBTB25 Antibody, zinc finger and BTB domain containing 25 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA054699-25 Anti-ZBTB25 Antibody, zinc finger and BTB domain containing 25 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZBTB25 Antibody

Anti-ZBTB25 Antibody

Target: Zinc finger and BTB domain containing 25
Type: Polyclonal antibody against Human ZBTB25

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody targeting human ZBTB25 protein.

Alternative Gene Names

  • C14orf51
  • KUP
  • ZNF46

Open Datasheet

Target Information

  • Target Protein: Zinc finger and BTB domain containing 25
  • Target Gene: ZBTB25

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

IGLDDGTADQQRACPATQALEEHQKPPVSIKQERCDPESVISQSHPSPSSEVTGPTFTENSVKIHLCHYCGERFDSRSNLR

Verified Species Reactivity

  • Human

Interspecies Information

Species Ortholog ID Sequence Identity
Rat ENSRNOG00000006441 86%
Mouse ENSMUSG00000056459 84%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.