CacheBy
Atlas Antibodies Anti-ZBTB22 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZBTB22 Antibody

상품 한눈에 보기

인간 ZBTB22 단백질을 인식하는 폴리클로날 항체로, WB 및 ICC 응용에 적합합니다. 재조합 단백질 기반 검증을 거쳤으며, 토끼에서 생산된 IgG 항체입니다. 친화 정제 방식으로 고순도 확보, 다양한 연구용으로 사용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA043848-100 Anti-ZBTB22 Antibody, zinc finger and BTB domain containing 22 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043848-25 Anti-ZBTB22 Antibody, zinc finger and BTB domain containing 22 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZBTB22 Antibody

Anti-ZBTB22 Antibody

Target: zinc finger and BTB domain containing 22
Supplier: Atlas Antibodies


  • WB (Western Blot): Recombinant expression validation using target protein overexpression
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human ZBTB22.


Alternative Gene Names

BING1, fru, fruitless, ZBTB22A, ZNF297, ZNF297A

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein zinc finger and BTB domain containing 22
Target Gene ZBTB22
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000000476 (82%), Mouse ENSMUSG00000051390 (80%)

Antigen Sequence:
SAVGSGERRGGGPVFPAPVVGSGGATSGKLLLEADELCDDGGDGRGAVVPGAGLRRPTYTPPSIMPQKHWVYVKRGGNCPAP


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Enhanced Validation
WB Recombinant Expression
Recombinant Expression Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.