CacheBy
Atlas Antibodies Anti-ZBTB18 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZBTB18 Antibody

상품 한눈에 보기

인간 ZBTB18 단백질을 인식하는 폴리클로날 항체로, 면역세포화학 등 다양한 응용에 적합. Rabbit 유래 IgG 항체이며 PrEST 항원으로 친화 정제됨. 인간과 높은 교차 반응성을 가진 Mouse 및 Rat에도 적용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA074019-100 Anti-ZBTB18 Antibody, zinc finger and BTB domain containing 18 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA074019-25 Anti-ZBTB18 Antibody, zinc finger and BTB domain containing 18 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZBTB18 Antibody

Anti-ZBTB18 Antibody

Target: Zinc finger and BTB domain containing 18 (ZBTB18)
Type: Polyclonal Antibody against Human ZBTB18

면역세포화학 (ICC) 등 다양한 응용에 사용 가능

Alternative Gene Names

C2H2-171, RP58, TAZ-1, ZNF238

Open Datasheet

Target Information

  • Target Protein: Zinc finger and BTB domain containing 18
  • Target Gene: ZBTB18
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
SYLHMYDIVKVCKKKLKEKATTEADSTKKEEDASSCSDKVESLSDGSSHIAGDLPSDEDEGEDEKLNILPSKRDLAAEPGNMWMRLPSDSAGIPQAGGEAEPHATAAGKTVASPCSSTESLSQRSVTSVRDSADVDCVLDLS

Verified Species Reactivity

Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000063659 99%
Rat ENSRNOG00000004423 98%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용에 대한 최적의 농도와 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.