CacheBy
Atlas Antibodies Anti-ZBTB11 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZBTB11 Antibody

상품 한눈에 보기

Human ZBTB11 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. Rabbit 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제됨. 인체 반응성이 검증되었으며, 안정한 PBS/glycerol 보존액에 포함됨.

카탈로그번호
HPA024138-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA024138-100 Anti-ZBTB11 Antibody, zinc finger and BTB domain containing 11 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA024138-25 Anti-ZBTB11 Antibody, zinc finger and BTB domain containing 11 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZBTB11 Antibody

Anti-ZBTB11 Antibody

Target Protein: zinc finger and BTB domain containing 11 (ZBTB11)
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG
Reactivity: Human


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human ZBTB11, a zinc finger and BTB domain containing protein.


Alternative Gene Names

  • ZNF-U69274
  • ZNF913

Open Datasheet (PDF)


Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen
Antigen Sequence:

KKGEVQTVASTQDLRVQNGGTAPPVASSEGTTTSLPTELGDCEIVLLVNGELPEAEQNGEVGRQPEPQVSSEAESALSSVGCIADSHPEMESVDLITKNNQTELETSNNRENNTVSNIHPKLS

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000022601 59%
Rat ENSRNOG00000001613 58%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Storage Notes Gently mix before use. Determine optimal concentrations and conditions for each application.
MSDS Material Safety Data Sheet

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.