CacheBy
Atlas Antibodies Anti-YWHAG Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-YWHAG Antibody

상품 한눈에 보기

인간 YWHAG 단백질을 인식하는 토끼 유래 폴리클로날 항체. WB 및 IHC에 적합하며 PrEST 항원으로 정제됨. 높은 종간 보존성(마우스, 랫 100%)을 보여 신뢰성 있는 단백질 검출 가능.

카탈로그번호
HPA026918-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA026918-100 Anti-YWHAG Antibody, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026918-25 Anti-YWHAG Antibody, tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-YWHAG Antibody

Anti-YWHAG Antibody

Target: tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human YWHAG.


Alternative Gene Names

  • PPP1R170

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma
Target Gene YWHAG
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000051391 (100%)
Rat ENSRNOG00000001436 (100%)

Antigen Sequence:
EAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEIS


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.