CacheBy
Atlas Antibodies Anti-YRDC Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-YRDC Antibody

상품 한눈에 보기

Human YRDC 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC에 적합합니다. Rabbit 유래 IgG 형식이며, PrEST 항원을 이용해 친화 정제되었습니다. Human에 반응성이 검증되었으며, Mouse와 Rat에서도 높은 상동성을 보입니다.

카탈로그번호
HPA030147-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA030147-100 Anti-YRDC Antibody, yrdC N(6)-threonylcarbamoyltransferase domain containing 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030147-25 Anti-YRDC Antibody, yrdC N(6)-threonylcarbamoyltransferase domain containing 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-YRDC Antibody

Anti-YRDC Antibody

Target: yrdC N(6)-threonylcarbamoyltransferase domain containing
Product Type: Polyclonal Antibody against Human YRDC


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against Human YRDC protein.


Alternative Gene Names

FLJ23476, IRIP, SUA5

Open Datasheet


Target Information

항목 내용
Target Protein yrdC N(6)-threonylcarbamoyltransferase domain containing
Target Gene YRDC
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence ASSLNVEEFQDLWPQLSLVIDGGQIGDGQSPECRLGSTVVDLSVPGKFGIIRPGCALESTTAILQQKYGLLP

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to:

  • Mouse ENSMUSG00000028889 (92%)
  • Rat ENSRNOG00000025424 (89%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.