
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-YRDC Antibody
상품 한눈에 보기
Human YRDC 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC에 적합합니다. Rabbit 유래 IgG 형식이며, PrEST 항원을 이용해 친화 정제되었습니다. Human에 반응성이 검증되었으며, Mouse와 Rat에서도 높은 상동성을 보입니다.
- 카탈로그번호
- HPA030147-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA030147-100 Anti-YRDC Antibody, yrdC N(6)-threonylcarbamoyltransferase domain containing 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030147-25 Anti-YRDC Antibody, yrdC N(6)-threonylcarbamoyltransferase domain containing 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-YRDC Antibody
Anti-YRDC Antibody
Target: yrdC N(6)-threonylcarbamoyltransferase domain containing
Product Type: Polyclonal Antibody against Human YRDC
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against Human YRDC protein.
Alternative Gene Names
FLJ23476, IRIP, SUA5
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | yrdC N(6)-threonylcarbamoyltransferase domain containing |
| Target Gene | YRDC |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | ASSLNVEEFQDLWPQLSLVIDGGQIGDGQSPECRLGSTVVDLSVPGKFGIIRPGCALESTTAILQQKYGLLP |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to:
- Mouse ENSMUSG00000028889 (92%)
- Rat ENSRNOG00000025424 (89%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



