CacheBy
Atlas Antibodies Anti-YIF1A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-YIF1A Antibody

상품 한눈에 보기

인간 YIF1A 단백질을 인식하는 폴리클로날 항체입니다. 면역조직화학(IHC) 및 웨스턴블롯(WB)에 적합합니다. 토끼에서 생산되었으며, Human, Mouse, Rat에 반응합니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다.

카탈로그번호
HPA076194-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA076194-100 Anti-YIF1A Antibody, Yip1 interacting factor homolog A, membrane trafficking protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA076194-25 Anti-YIF1A Antibody, Yip1 interacting factor homolog A, membrane trafficking protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-YIF1A Antibody

Anti-YIF1A Antibody

Yip1 interacting factor homolog A (S. cerevisiae)

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human YIF1A.

Alternative Gene Names

54TM, FinGER7, YIF1, YIF1P

Open Datasheet

Target Information

항목 내용
Target Protein Yip1 interacting factor homolog A (S. cerevisiae)
Target Gene YIF1A
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence ALMYFIVRSLRTAALGPDSMGGPVPRQRLQ

Verified Species Reactivity

Human, Mouse, Rat

Interspecies Information

유전자 ID 항원 서열 동일성
Mouse ENSMUSG00000024875 93%
Rat ENSRNOG00000020201 87%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.