CacheBy
Atlas Antibodies Anti-YEATS2 Antibody
원본

Atlas Antibodies Anti-YEATS2 Antibody

상품 한눈에 보기

인간 YEATS2 단백질을 인식하는 폴리클로날 항체. IHC 및 ICC 응용에 적합. 토끼 유래 IgG로 PrEST 항원 친화 정제. 인간과 높은 종간 반응성 검증됨. 40% 글리세롤 PBS 완충액에 보존.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA045891-100 Anti-YEATS2 Antibody, YEATS domain containing 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045891-25 Anti-YEATS2 Antibody, YEATS domain containing 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-YEATS2 Antibody

Anti-YEATS2 Antibody

Target Information

  • Target Protein: YEATS domain containing 2
  • Target Gene: YEATS2
  • Alternative Gene Names: FLJ10201, FLJ12841, FLJ13308, KIAA1197
  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human YEATS2, produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

GLLKVSEGSKTCDTMVFNHPAIKKFLESPSRSSSPANQRAETPSANHSESDSLSQHNDFLSDKDNNSNMDIEERLSNNMEQRPSRNTGRDT

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Rat ENSRNOG00000023107 87%
Mouse ENSMUSG00000041215 84%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Storage Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Material Safety Data Sheet
Open Datasheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.