Atlas Antibodies Anti-YEATS2 Antibody

상품 한눈에 보기

인간 YEATS2 단백질을 인식하는 폴리클로날 항체. IHC 및 ICC 응용에 적합. 토끼 유래 IgG로 PrEST 항원 친화 정제. 인간과 높은 종간 반응성 검증됨. 40% 글리세롤 PBS 완충액에 보존.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA045891-100 Anti-YEATS2 Antibody, YEATS domain containing 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA045891-25 Anti-YEATS2 Antibody, YEATS domain containing 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Polyclonal antibody against human YEATS2, produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

GLLKVSEGSKTCDTMVFNHPAIKKFLESPSRSSSPANQRAETPSANHSESDSLSQHNDFLSDKDNNSNMDIEERLSNNMEQRPSRNTGRDT

Highest antigen sequence identity to the following orthologs:

Species	Gene ID	Identity
Rat	ENSRNOG00000023107	87%
Mouse	ENSMUSG00000041215	84%

Property	Description
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Storage Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.